PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA07g13700
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family M-type_MADS
Protein Properties Length: 225aa    MW: 25839.9 Da    PI: 9.8404
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA07g13700genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF30.26e-101047239
                ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEE CS
      SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevavii 39
                + +++ nr+ t  kR++ + KK + L +LC++++++ii
  CA07g13700 10 FTQDHKNRKSTCVKRKASLVKKISKLAILCGIKACMII 47
                567899*******************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006614.213147IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.75E-13153IPR002100Transcription factor, MADS-box
SMARTSM004322.0E-7164IPR002100Transcription factor, MADS-box
PfamPF003191.0E-91247IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 225 aa     Download sequence    Send to blast
MGRAKINMEF TQDHKNRKST CVKRKASLVK KISKLAILCG IKACMIIDGG ITDQDISQHD  60
QIWPNDPKQV HELINLYKAQ PLQGRSKRAK TLSNFFENQK KKVEVKAENY PTWDSRFDYL  120
SEKELRNLAC VLERRIENAK GKAGFLKRTN IGSSSLLSRQ EILDYTELMN YNNNLMNQTT  180
SWWPSIDYNF FQANIPSGVN SMGVEWIIDL LLPLIINLTM QIIL*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016555459.11e-167PREDICTED: agamous-like MADS-box protein AGL82
TrEMBLM1DA131e-66M1DA13_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000856763e-66(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA63421232
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G55690.17e-19M-type_MADS family protein